Structure of PDB 4lmg Chain A

Receptor sequence
>4lmgA (length=120) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
LIHLDPVPSFEDRHEIKPWLQKIFYPQGIDIVIERSDSSKVTFKCRSVAC
PFRIRAAYSVRLQKWNVVVMNNIHSHELRFDLITKTDDYKKFKENLRQKN
DEKAIKTFDELEYKASLNLP
3D structure
PDB4lmg Molecular mechanism and structure of the Saccharomyces cerevisiae iron regulator Aft2.
ChainA
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Q157 N159 Q98 N100
BS02 dna A R54 K58 V73 I74 E75 S77 S88 R13 K17 V32 I33 E34 S36 S47
BS03 dna A R76 D78 K81 R112 R35 D37 K40 R53
BS04 ZN A C86 C109 H133 H135 C45 C50 H74 H76
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
Biological Process
GO:0010106 cellular response to iron ion starvation
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4lmg, PDBe:4lmg, PDBj:4lmg
PDBsum4lmg
PubMed24591629
UniProtQ08957|AFT2_YEAST Iron-regulated transcriptional activator AFT2 (Gene Name=AFT2)

[Back to BioLiP]