Structure of PDB 4llb Chain A

Receptor sequence

>4llbA (length=123) Species: 9606 (Homo sapiens) [Search protein sequence]

HMLELPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHP
SCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFH
MECCDPPLTRMPKGMWICQICRP

3D structure

PDB

4llb The double PHD finger domain of MOZ/MYST3 induces alpha-helical structure of the histone H3 tail to facilitate acetylation and methylation sampling and modification.

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.3.1.48: histone acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	S210 F211 N235 S236 C241 L242 W257 C259 I260 E261 Q271 A275 D276 N277 M278 F280 D282 D285 M300	S21 F22 N46 S47 C52 L53 W68 C70 I71 E72 Q82 A86 D87 N88 M89 F91 D93 D96 M111
BS02	ZN	A	C281 C284 C310	C92 C95 C121
BS03	ZN	A	C265 C268 H289 C292	C76 C79 H100 C103
BS04	ZN	A	C209 C212 H238 C241	C20 C23 H49 C52
BS05	ZN	A	C230 C233 C259 C262	C41 C44 C70 C73

External links

PDB	RCSB:4llb, PDBe:4llb, PDBj:4llb
PDBsum	4llb
PubMed	24150941
UniProt	Q92794\|KAT6A_HUMAN Histone acetyltransferase KAT6A (Gene Name=KAT6A)

[Back to BioLiP]