Structure of PDB 4ll3 Chain A

Receptor sequence
>4ll3A (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence]
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGI
GGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
3D structure
PDB4ll3 Thermodynamic and structural analysis of HIV protease resistance to darunavir - analysis of heavily mutated patient-derived HIV-1 proteases.
ChainA
Resolution1.95 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D25 T26 G27
Catalytic site (residue number reindexed from 1) D25 T26 G27
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 017 A D25 G27 A28 D30 P81 I84 D25 G27 A28 D30 P81 I84 MOAD: Kd=2.7pM
PDBbind-CN: -logKd/Ki=11.57,Kd=2.7pM
BS02 017 A D25 G27 A28 D29 G48 G49 I50 D25 G27 A28 D29 G48 G49 I50 MOAD: Kd=2.7pM
PDBbind-CN: -logKd/Ki=11.57,Kd=2.7pM
Gene Ontology
Molecular Function
GO:0004190 aspartic-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ll3, PDBe:4ll3, PDBj:4ll3
PDBsum4ll3
PubMed24785545
UniProtQ9WFL7

[Back to BioLiP]