Structure of PDB 4l7x Chain A

Receptor sequence
>4l7xA (length=58) Species: 9606 (Homo sapiens) [Search protein sequence]
GPLPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGE
DYICPNCT
3D structure
PDB4l7x Dido3 PHD Modulates Cell Differentiation and Division.
ChainA
Resolution1.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A Y8 H15 N17 F19 M20 I21 C22 E27 W29 E39 L45 E46 E50 Y8 H15 N17 F19 M20 I21 C22 E27 W29 E39 L45 E46 E50
BS02 ZN A C23 C26 C54 C57 C23 C26 C54 C57
BS03 ZN A C9 C11 H31 C34 C9 C11 H31 C34
Gene Ontology
Biological Process
GO:0097190 apoptotic signaling pathway
Cellular Component
GO:0048188 Set1C/COMPASS complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4l7x, PDBe:4l7x, PDBj:4l7x
PDBsum4l7x
PubMed23831028
UniProtQ9BTC0|DIDO1_HUMAN Death-inducer obliterator 1 (Gene Name=DIDO1)

[Back to BioLiP]