Structure of PDB 4l58 Chain A

Receptor sequence

>4l58A (length=65) Species: 9606 (Homo sapiens)

DVTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPR
NLDKERAVLLQRRKR

3D structure

• PDB: 4l58 Molecular basis for chromatin binding and regulation of MLL5.
• Chain: A
• Resolution: 1.48 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.43: Transferred entry: 2.1.1.354.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	D12 G14 Y15 M16 I17 W25 P39 D40	D12 G14 Y15 M16 I17 W25 P39 D40
BS02	ZN	A	C19 C22 C44 C47	C19 C22 C44 C47
BS03	ZN	A	C5 C7 H27 C30	C5 C7 H27 C30

External links

• PDB: RCSB:4l58, PDBe:4l58, PDBj:4l58
• PDBsum: 4l58
• PubMed: 23798402
• UniProt: Q8IZD2|KMT2E_HUMAN Inactive histone-lysine N-methyltransferase 2E (Gene Name=KMT2E)