Structure of PDB 4l3k Chain A |
>4l3kA (length=141) Species: 1474 (Sporosarcina pasteurii) [Search protein sequence] |
MLITKIVGHIDDYESSDKKVDWLEVEWEDLNKRILRKETENGTDIAIKLE NSGTLRYGDVLYESDDTLIAIRTKLEKVYVIKPQTMQEMGKMAFEIGNRH TMCIIEDDEILVRYDKTLEKLIDEVGVSYEQSERRFKEPFK |
|
PDB | 4l3k Selectivity of Ni(II) and Zn(II) binding to Sporosarcina pasteurii UreE, a metallochaperone in the urease assembly: a calorimetric and crystallographic study. |
Chain | A |
Resolution | 1.88 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H9 D12 |
H9 D12 |
|
|
|
|