Structure of PDB 4kva Chain A

Receptor sequence
>4kvaA (length=246) Species: 6183 (Schistosoma mansoni) [Search protein sequence]
FVFNILCVGETGIGKSTLLETLFNQKFDFPKLKAVTYDLKKLKLTVVETC
GYGDENNIKPVVDYIDNQFENYLQEELKMKRSMQAFHDTRVHVCLYFIAP
TGHSLKSIDLVAMKKLENKVNVIPVIAKSDTITKSELQKFKARILSEIQS
NEIGIYQFPTDDEAVSETNSVMNQHIPFAVVGSSEEVKTVRVRQYPWGSV
QVENENHCDFVRLREMLLRVNMEDLRERTHGVHYETYRRQRLIEMG
3D structure
PDB4kva Crystal Structure of a Schistosoma mansoni Septin Reveals the Phenomenon of Strand Slippage in Septins Dependent on the Nature of the Bound Nucleotide.
ChainA
Resolution2.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GTP A T50 G51 G53 K54 S55 T56 E100 K184 D186 V237 R253 T11 G12 G14 K15 S16 T17 E48 K128 D130 V181 R193 MOAD: Kd=0.000115M
PDBbind-CN: -logKd/Ki=3.94,Kd=115uM
BS02 MG A S55 E100 S16 E48
BS03 GTP A T187 E192 T131 E136 MOAD: Kd=0.000115M
PDBbind-CN: -logKd/Ki=3.94,Kd=115uM
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003924 GTPase activity
GO:0005525 GTP binding
GO:0019003 GDP binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0046982 protein heterodimerization activity
GO:0060090 molecular adaptor activity
Biological Process
GO:0051260 protein homooligomerization
GO:0061640 cytoskeleton-dependent cytokinesis
Cellular Component
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005940 septin ring
GO:0015630 microtubule cytoskeleton
GO:0031105 septin complex
GO:0031982 vesicle
GO:0032153 cell division site

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4kva, PDBe:4kva, PDBj:4kva
PDBsum4kva
PubMed24464615
UniProtA0A3Q0KDV9|SEP10_SCHMA Septin-10 (Gene Name=SEPT10)

[Back to BioLiP]