Structure of PDB 4kv4 Chain A |
>4kv4A (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] |
AGSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPM DMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQD VFEMRFAKMPD |
|
PDB | 4kv4 Brd4 maintains constitutively active NF-kappa B in cancer cells by binding to acetylated RelA. |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
W29 V35 N88 H92 |
W26 V32 N85 H89 |
|
|
|