Structure of PDB 4kud Chain A

Receptor sequence

>4kudA (length=96) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

PHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGE

3D structure

PDB

4kud N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain.

Chain

Resolution

3.203 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Y41 K42 R72 R83 F84 Q85 V117 T118	Y4 K5 R35 R46 F47 Q48 V80 T81	PDBbind-CN: Kd=0.04uM
BS02	dna	A	R40 Y41 G44 V46 A47 R49 R63 L65 R69 R83	R3 Y4 G7 V9 A10 R12 R26 L28 R32 R46	PDBbind-CN: Kd=0.04uM

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0008823	cupric reductase (NADH) activity
GO:0030527	structural constituent of chromatin
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0006325	chromatin organization
GO:0006355	regulation of DNA-templated transcription
GO:0006878	intracellular copper ion homeostasis
GO:0009060	aerobic respiration
GO:0009303	rRNA transcription
GO:0042790	nucleolar large rRNA transcription by RNA polymerase I
GO:0043935	sexual sporulation resulting in formation of a cellular spore
GO:0045943	positive regulation of transcription by RNA polymerase I
GO:0070911	global genome nucleotide-excision repair

	Cellular Component
GO:0000500	RNA polymerase I upstream activating factor complex
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0031298	replication fork protection complex
GO:0032991	protein-containing complex
GO:0043505	CENP-A containing nucleosome

External links

PDB	RCSB:4kud, PDBe:4kud, PDBj:4kud
PDBsum	4kud
PubMed	23934152
UniProt	P61830\|H3_YEAST Histone H3 (Gene Name=HHT1)