Structure of PDB 4kpr Chain A

Receptor sequence
>4kprA (length=484) Species: 10116 (Rattus norvegicus) [Search protein sequence]
YDFDLIIIGGGSGGLAAAKEAAKFDKKVMVLDFVTPTPLGTRWGLGGTCV
NVGCIPKKLMHQAALLGQALKDSRNYGWKLEDTVKHDWEKMTESVQNHIG
SLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERFLIA
TGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLA
GIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIE
AGTPGRLKVTAKSTNSEETIEDEFNTVLLAVGRDSCTRTIGLETVGVKIN
EKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGG
STVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSFFWPLE
WTVPSRDNNKCYAKVICNLKDNERVVGFHVLGPNAGEVTQGFAAALKCGL
TKQQLDSTIGIHPVCAEIFTTLSVTKRSGGDILQ
3D structure
PDB4kpr The Trp114 residue of thioredoxin reductase 1 is an electron relay sensor for oxidative stress
ChainA
Resolution2.4 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) L55 C59 C64 K67 Y200 E204 G470 H472 E477
Catalytic site (residue number reindexed from 1) L45 C49 C54 K57 Y190 E194 G460 H462 E467
Enzyme Commision number 1.11.1.2: NADPH peroxidase.
1.8.1.9: thioredoxin-disulfide reductase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FAD A G21 S22 G23 L41 D42 F43 G57 T58 C59 G63 C64 K67 Y131 G132 T161 G162 Y200 V201 R293 G333 D334 E341 L342 T343 G11 S12 G13 L31 D32 F33 G47 T48 C49 G53 C54 K57 Y121 G122 T151 G152 Y190 V191 R283 G323 D324 E331 L332 T333
Gene Ontology
Molecular Function
GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
GO:0016174 NAD(P)H oxidase H2O2-forming activity
GO:0016491 oxidoreductase activity
GO:0016668 oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor
GO:0033797 selenate reductase activity
GO:0042802 identical protein binding
GO:0045340 mercury ion binding
GO:0050137 NADPH peroxidase activity
GO:0050660 flavin adenine dinucleotide binding
GO:0071949 FAD binding
Biological Process
GO:0001707 mesoderm formation
GO:0006979 response to oxidative stress
GO:0007369 gastrulation
GO:0008283 cell population proliferation
GO:0009410 response to xenobiotic stimulus
GO:0010269 response to selenium ion
GO:0016259 selenocysteine metabolic process
GO:0042537 benzene-containing compound metabolic process
GO:0042744 hydrogen peroxide catabolic process
GO:0043065 positive regulation of apoptotic process
GO:0045454 cell redox homeostasis
GO:0048678 response to axon injury
GO:0055093 response to hyperoxia
GO:0070276 halogen metabolic process
GO:0070995 NADPH oxidation
GO:0071280 cellular response to copper ion
GO:0071455 cellular response to hyperoxia
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0043025 neuronal cell body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4kpr, PDBe:4kpr, PDBj:4kpr
PDBsum4kpr
PubMed
UniProtO89049|TRXR1_RAT Thioredoxin reductase 1, cytoplasmic (Gene Name=Txnrd1)

[Back to BioLiP]