Structure of PDB 4ko7 Chain A |
>4ko7A (length=128) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] |
AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNFVL STAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVS KLKEGEQYMFFCTFPGHSALMKGTLTLK |
|
PDB | 4ko7 Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/W48F/V95I) |
Chain | A |
Resolution | 2.07 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H46 C112 H117 |
H46 C112 H117 |
|
|
|
|