Structure of PDB 4kgc Chain A

Receptor sequence

>4kgcA (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence]

PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER

3D structure

PDB

4kgc Ligand substitutions between ruthenium-cymene compounds can control protein versus DNA targeting and anticancer activity

Chain

Resolution

2.69 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	H39 R40 R42 P43 T45 R63 R72 R83 F84 Q85 S86 R116 V117 T118	H2 R3 R5 P6 T8 R26 R35 R46 F47 Q48 S49 R79 V80 T81
BS02	dna	A	H39 R40 Y41 P43 G44 V46 A47 R49 R63 K64 L65 P66 R69 R83	H2 R3 Y4 P6 G7 V9 A10 R12 R26 K27 L28 P29 R32 R46

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0046982	protein heterodimerization activity

External links