Structure of PDB 4k9f Chain A |
>4k9fA (length=53) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence] |
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFE KLE |
|
PDB | 4k9f The IMAGINE instrument: first neutron protein structure and new capabilities for neutron macromolecular crystallography. |
Chain | A |
Resolution | 1.75 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
A |
C5 C8 Y10 C38 C41 |
C6 C9 Y11 C39 C42 |
|
|
|
|