Structure of PDB 4k60 Chain A

Receptor sequence
>4k60A (length=219) Species: 9606 (Homo sapiens) [Search protein sequence]
IIGGTECKPHSRPYMAYLEIVTNGPSKFCGGFLIRRNFVLTAAHCAGRSI
TVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASL
TLAVGTLPFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHF
RDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPA
VFTRISHYQPWINQILQAN
3D structure
PDB4k60 Discovery of Potent, Selective Chymase Inhibitors via Fragment Linking Strategies.
ChainA
Resolution1.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 K192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H44 D88 K172 G173 D174 S175 G176
Enzyme Commision number 3.4.21.39: chymase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H25 E78 H10 E63
BS02 1P8 A A190 F191 K192 G216 A226 A170 F171 K172 G192 A200 MOAD: ic50=570uM
PDBbind-CN: -logKd/Ki=3.24,IC50=570uM
BindingDB: IC50=570000nM
Gene Ontology
Molecular Function
GO:0004175 endopeptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
GO:0042277 peptide binding
Biological Process
GO:0002003 angiotensin maturation
GO:0006508 proteolysis
GO:0006518 peptide metabolic process
GO:0016485 protein processing
GO:0022617 extracellular matrix disassembly
GO:0030163 protein catabolic process
GO:0030901 midbrain development
GO:0034769 basement membrane disassembly
GO:0045766 positive regulation of angiogenesis
GO:0050727 regulation of inflammatory response
GO:0071333 cellular response to glucose stimulus
GO:0140447 cytokine precursor processing
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0030141 secretory granule
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0043231 intracellular membrane-bounded organelle
GO:0062023 collagen-containing extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4k60, PDBe:4k60, PDBj:4k60
PDBsum4k60
PubMed23659209
UniProtP23946|CMA1_HUMAN Chymase (Gene Name=CMA1)

[Back to BioLiP]