Structure of PDB 4k4d Chain A

Receptor sequence
>4k4dA (length=137) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTRTHQPF
GLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRG
VCQPLHLGRQNQSWEIVVFDEQGRRCCTCRLGTAVLG
3D structure
PDB4k4d Structure and Catalysis in the Escherichia coli Hotdog-fold Thioesterase Paralogs YdiI and YbdB.
ChainA
Resolution2.17 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.2.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HFQ A Q48 P49 L53 H54 G55 H89 H90 P92 Q48 P49 L53 H54 G55 H89 H90 P92 MOAD: Ki=5.9uM
BS02 HFQ A S67 V81 G82 S67 V81 G82 MOAD: Ki=5.9uM
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016289 acyl-CoA hydrolase activity
GO:0016787 hydrolase activity
GO:0016788 hydrolase activity, acting on ester bonds
GO:0016790 thiolester hydrolase activity
GO:0042802 identical protein binding
GO:0061522 1,4-dihydroxy-2-naphthoyl-CoA thioesterase activity
Biological Process
GO:0009239 enterobactin biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4k4d, PDBe:4k4d, PDBj:4k4d
PDBsum4k4d
PubMed25010423
UniProtP0A8Y8|ENTH_ECOLI Proofreading thioesterase EntH (Gene Name=entH)

[Back to BioLiP]