Structure of PDB 4k46 Chain A

Receptor sequence
>4k46A (length=214) Species: 74109 (Photobacterium profundum) [Search protein sequence]
MRIILLGAPGAGKGTQAQFIMAKFGIPQISTGDMLRAAIKAGTELGKQAK
SVIDAGQLVSDDIILGLVKERIAQDDCAKGFLLDGFPRTIPQADGLKEVG
VVVDYVIEFDVADSVIVERMAGRRAHLASGRTYHNVYNPPKVEGKDDVTG
EDLVIREDDKEETVLARLGVYHNQTAPLIAYYGKEAEAGNTQYLKFDGTK
AVAEVSAELEKALA
3D structure
PDB4k46 Alike but Different: Adenylate kinases from E. Coli, Aquifex, and P. profundum
ChainA
Resolution2.01 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K13 R88 R123 R156 R167
Catalytic site (residue number reindexed from 1) K13 R88 R123 R156 R167
Enzyme Commision number 2.7.4.3: adenylate kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP A G10 G12 K13 G14 T15 R119 M120 R123 T132 Y133 H134 Y137 K200 V202 G10 G12 K13 G14 T15 R119 M120 R123 T132 Y133 H134 Y137 K200 V202
BS02 AMP A T31 G32 L35 R36 I53 Q57 V59 I64 R88 Q92 T31 G32 L35 R36 I53 Q57 V59 I64 R88 Q92
Gene Ontology
Molecular Function
GO:0004017 adenylate kinase activity
GO:0004550 nucleoside diphosphate kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016776 phosphotransferase activity, phosphate group as acceptor
GO:0019205 nucleobase-containing compound kinase activity
GO:0050145 nucleoside monophosphate kinase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0009123 nucleoside monophosphate metabolic process
GO:0009132 nucleoside diphosphate metabolic process
GO:0009165 nucleotide biosynthetic process
GO:0016310 phosphorylation
GO:0044209 AMP salvage
GO:0046940 nucleoside monophosphate phosphorylation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4k46, PDBe:4k46, PDBj:4k46
PDBsum4k46
PubMed
UniProtQ6LTE1|KAD_PHOPR Adenylate kinase (Gene Name=adk)

[Back to BioLiP]