Structure of PDB 4k38 Chain A

Receptor sequence

>4k38A (length=369) Species: 195103 (Clostridium perfringens ATCC 13124)

PPLSLLIKPASSGCNLKCTYCFYHSLSDNRNVKSYGIMRDEVLESMVKRV
LNEANGHCSFAFQGGEPTLAGLEFFEKLMELQRKHNYKNLKIYNSLQTNG
TLIDESWAKFLSENKFLVGLSMDGPKEIHNLNRKDCCGLDTFSKVERAAE
LFKKYKVEFNILCVVTSNTARHVNKVYKYFKEKDFKFLQFINCLDPLYEE
KGKYNYSLKPKDYTKFLKNLFDFWYEDFLNGNRVSIRYFDGLLETILLGK
SSSCGMNGTCTCQFVVESDGSVYPCDFYVLDKWRLGNIQDMTMKELFETN
KNHEFIKLSFKVHEECKKCKWFRLCKGGCRRCRDSKEDSALELNYYCQSY
KEFFEYAFPRLINVANNIK

3D structure

• PDB: 4k38 X-ray structure of an AdoMet radical activase reveals an anaerobic solution for formylglycine posttranslational modification.
• Chain: A
• Resolution: 1.831 Å

Enzymatic activity

• Enzyme Commision number: 1.8.98.7: cysteine-type anaerobic sulfatase-maturating enzyme.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	Q64 L118 G120 E159 F160 N161 F188 Q190 R238 S253 C255	Q63 L117 G119 E158 F159 N160 F187 Q189 R237 S252 C254
BS02	SF4	A	C255 G256 C261 T262 Q264 C276 F278 C330 R331 R332	C254 G255 C260 T261 Q263 C275 F277 C329 R330 R331
BS03	SF4	A	C317 C320 F323 C326 G328 C348 K352	C316 C319 F322 C325 G327 C347 K351
BS04	SF4	A	C15 L17 C19 C22 G66 N100 R134	C14 L16 C18 C21 G65 N99 R133
BS05	SAM	A	Y21 F23 Y24 Q64 G65 G66 E67 Q98 T99 S122 R134 V165 I192 C194 L195	Y20 F22 Y23 Q63 G64 G65 E66 Q97 T98 S121 R133 V164 I191 C193 L194

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

External links

• PDB: RCSB:4k38, PDBe:4k38, PDBj:4k38
• PDBsum: 4k38
• PubMed: 23650368
• UniProt: Q0TTH1|ANSME_CLOP1 Cysteine-type anaerobic sulfatase-maturating enzyme (Gene Name=CPF_0616)