Structure of PDB 4k2r Chain A

Receptor sequence
>4k2rA (length=551) Species: 9606 (Homo sapiens) [Search protein sequence]
PDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLV
HDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKP
CNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEK
LIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALS
LIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLK
EACPNSDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGC
GNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNP
YIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVS
MGMKYLEEKNFVHRNLAARNVLLVNRHYAKISDFGLSWPLKWYAPECINF
RKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPE
CPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGGSGLEVL
F
3D structure
PDB4k2r Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
ChainA
Resolution3.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) N461 A463 R465 N466 D479
Catalytic site (residue number reindexed from 1) N415 A417 R419 N420 D433
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A N466 D479 N420 D433
BS02 ANP A L344 V352 A367 K369 A417 P421 R465 N466 L468 D479 L298 V306 A321 K323 A371 P375 R419 N420 L422 D433
Gene Ontology
Molecular Function
GO:0001784 phosphotyrosine residue binding
GO:0004672 protein kinase activity
GO:0004713 protein tyrosine kinase activity
GO:0004715 non-membrane spanning protein tyrosine kinase activity
GO:0005102 signaling receptor binding
GO:0005515 protein binding
GO:0005524 ATP binding
Biological Process
GO:0002250 adaptive immune response
GO:0002684 positive regulation of immune system process
GO:0006468 protein phosphorylation
GO:0006955 immune response
GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway
GO:0016310 phosphorylation
GO:0018108 peptidyl-tyrosine phosphorylation
GO:0019722 calcium-mediated signaling
GO:0030154 cell differentiation
GO:0030217 T cell differentiation
GO:0035556 intracellular signal transduction
GO:0042110 T cell activation
GO:0042113 B cell activation
GO:0043366 beta selection
GO:0045059 positive thymic T cell selection
GO:0045060 negative thymic T cell selection
GO:0045061 thymic T cell selection
GO:0045087 innate immune response
GO:0045582 positive regulation of T cell differentiation
GO:0046632 alpha-beta T cell differentiation
GO:0046638 positive regulation of alpha-beta T cell differentiation
GO:0046641 positive regulation of alpha-beta T cell proliferation
GO:0050776 regulation of immune response
GO:0050850 positive regulation of calcium-mediated signaling
GO:0050852 T cell receptor signaling pathway
GO:0070489 T cell aggregation
GO:0072678 T cell migration
Cellular Component
GO:0001772 immunological synapse
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005911 cell-cell junction
GO:0016020 membrane
GO:0031234 extrinsic component of cytoplasmic side of plasma membrane
GO:0042101 T cell receptor complex
GO:0045121 membrane raft

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4k2r, PDBe:4k2r, PDBj:4k2r
PDBsum4k2r
PubMed23530057
UniProtP43403|ZAP70_HUMAN Tyrosine-protein kinase ZAP-70 (Gene Name=ZAP70)

[Back to BioLiP]