Structure of PDB 4jv2 Chain A

Receptor sequence

>4jv2A (length=341) Species: 273057 (Saccharolobus solfataricus P2)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 4jv2 Ring-Opening of the gamma-OH-PdG Adduct Promotes Error-Free Bypass by the Sulfolobus solfataricus DNA Polymerase Dpo4.
• Chain: A
• Resolution: 2.74 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	V32 A42 E219 A220 R242 K243 S244 I245 G246 R247 I248 R331 R332 R336	V32 A42 E219 A220 R242 K243 S244 I245 G246 R247 I248 R331 R332 R336
BS02	dna	A	P184 G185 G187 I189 T190 V296 S297 R298 T301 K339	P184 G185 G187 I189 T190 V296 S297 R298 T301 K339
BS03	DTP	A	D7 Y10 F11 Y12 A44 T45 R51 A57 D105 K159	D7 Y10 F11 Y12 A44 T45 R51 A57 D105 K159
BS04	CA	A	D7 F8 D105	D7 F8 D105

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4jv2, PDBe:4jv2, PDBj:4jv2
• PDBsum: 4jv2
• PubMed: 23947567
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)