Structure of PDB 4jv2 Chain A
Receptor sequence
| >4jv2A (length=341) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] |
| MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI |
3D structure
| PDB | 4jv2 Ring-Opening of the gamma-OH-PdG Adduct Promotes Error-Free Bypass by the Sulfolobus solfataricus DNA Polymerase Dpo4. | ||
| Chain | A | ||
| Resolution | 2.74 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | 2.7.7.7: DNA-directed DNA polymerase. |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | dna | A | V32 A42 E219 A220 R242 K243 S244 I245 G246 R247 I248 R331 R332 R336 | V32 A42 E219 A220 R242 K243 S244 I245 G246 R247 I248 R331 R332 R336 | |
| BS02 | dna | A | P184 G185 G187 I189 T190 V296 S297 R298 T301 K339 | P184 G185 G187 I189 T190 V296 S297 R298 T301 K339 | |
| BS03 | DTP | A | D7 Y10 F11 Y12 A44 T45 R51 A57 D105 K159 | D7 Y10 F11 Y12 A44 T45 R51 A57 D105 K159 | |
| BS04 | CA | A | D7 F8 D105 | D7 F8 D105 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0000287 | magnesium ion binding |
| GO:0003677 | DNA binding |
| GO:0003684 | damaged DNA binding |
| GO:0003887 | DNA-directed DNA polymerase activity |
| GO:0046872 | metal ion binding |
