Structure of PDB 4jqe Chain A

Receptor sequence
>4jqeA (length=369) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
CRVWSEARVYTNINKQRTEEYWDYENTVIDWSTNTKDYEIENKVGRGKYS
EVFQGVKLDSKVKIVIKMLKPVKKKKIKREIKILTDLSNEKVPPTTLPFQ
KDQYYTNQKEDVLKFIRPYIFDQPHNGHANIIHLFDIIKDPISKTPALVF
EYVDNVDFRILYPKLTDLEIRFYMFELLKALDYCHSMGIMHRDVKPHNVM
IDHKNKKLRLIDWGLAEFYHVNMEYNVRVASRFFKGPELLVDYRMYDYSL
DLWSFGTMLASMIFKREPFFHGTSNTDQLVKIVKVLGTSDFEKYLLKYEI
TLPREFYDMDQYIRKPWHRFINDGNKHLSGNDEIIDLIDNLLRYDHQERL
TAKEAMGHPWFAPIREQIE
3D structure
PDB4jqe The multiple nucleotide-divalent cation binding modes of Saccharomyces cerevisiae CK2 alpha indicate a possible co-substrate hydrolysis product (ADP/GDP) release pathway.
ChainA
Resolution1.77 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D195 K197 N200 D214 S233
Catalytic site (residue number reindexed from 1) D193 K195 N198 D212 S231
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ANP A R48 G49 K50 S52 V54 V67 K69 V155 I213 D214 R46 G47 K48 S50 V52 V65 K67 V153 I211 D212
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0044024 histone H2AS1 kinase activity
GO:0106310 protein serine kinase activity
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006338 chromatin remodeling
GO:0006356 regulation of transcription by RNA polymerase I
GO:0006359 regulation of transcription by RNA polymerase III
GO:0006468 protein phosphorylation
GO:0006974 DNA damage response
GO:0007535 donor selection
GO:0016310 phosphorylation
GO:0030490 maturation of SSU-rRNA
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0051726 regulation of cell cycle
GO:0060962 regulation of ribosomal protein gene transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005829 cytosol
GO:0005956 protein kinase CK2 complex
GO:0032040 small-subunit processome
GO:0032545 CURI complex
GO:0034456 UTP-C complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jqe, PDBe:4jqe, PDBj:4jqe
PDBsum4jqe
PubMed24531484
UniProtP15790|CSK21_YEAST Casein kinase II subunit alpha (Gene Name=CKA1)

[Back to BioLiP]