Structure of PDB 4jqc Chain A

Receptor sequence
>4jqcA (length=258) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEE
FAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQL
DGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAE
RAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGI
KDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGG
FSIAAMNE
3D structure
PDB4jqc Crystal Structure of E.coli Enoyl Reductase in Complex with NAD and AFN-1252
ChainA
Resolution2.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) A27 R30 A33 E49 A52 A53 D118 Y146 Y156 K163
Catalytic site (residue number reindexed from 1) A27 R30 A33 E49 A52 A53 D118 Y146 Y156 K163
Enzyme Commision number 1.3.1.9: enoyl-[acyl-carrier-protein] reductase (NADH).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAD A G13 A15 I20 Q40 D64 V65 S91 I92 I119 L144 S145 K163 A189 I192 T194 L195 A196 G13 A15 I20 Q40 D64 V65 S91 I92 I119 L144 S145 K163 A189 I192 T194 L195 A196
BS02 0WE A F94 A95 L100 Y146 N155 Y156 A196 S198 I200 F94 A95 L100 Y146 N155 Y156 A196 S198 I200
Gene Ontology
Molecular Function
GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0042802 identical protein binding
GO:0070404 NADH binding
Biological Process
GO:0006633 fatty acid biosynthetic process
GO:0008610 lipid biosynthetic process
GO:0009102 biotin biosynthetic process
GO:0030497 fatty acid elongation
GO:0046677 response to antibiotic
GO:0051289 protein homotetramerization
Cellular Component
GO:0005829 cytosol
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:1902494 catalytic complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jqc, PDBe:4jqc, PDBj:4jqc
PDBsum4jqc
PubMed
UniProtP0AEK4|FABI_ECOLI Enoyl-[acyl-carrier-protein] reductase [NADH] FabI (Gene Name=fabI)

[Back to BioLiP]