Structure of PDB 4jnj Chain A

Receptor sequence

>4jnjA (length=115) Species: 1895 (Streptomyces avidinii)

GAEAGITGTWYNQSGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTG
RYNGTKLEWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGS
GPATEQGQDTFTKVK

3D structure

• PDB: 4jnj Structure-based engineering of streptavidin monomer with a reduced biotin dissociation rate.
• Chain: A
• Resolution: 1.902 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BTN	A	S27 Y43 N45 A47 G49 W79 S88 T90 W108 D128	S16 Y32 N34 A36 G40 W63 S72 T74 W92 D109	PDBbind-CN: -logKd/Ki=9.07,Kd=0.85nM
BS02	ZN	A	H87 E113	H71 E97
BS03	ZN	A	G12 E14	G1 E3

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Dec 19 01:22:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4jnj', asym_id = 'A', title = 'Structure-based engineering of streptavidin monomer with a reduced biotin dissociation rate.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4jnj', asym_id='A', title='Structure-based engineering of streptavidin monomer with a reduced biotin dissociation rate.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009374', uniprot = '', pdbid = '4jnj', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009374', uniprot='', pdbid='4jnj', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>