Structure of PDB 4jlw Chain A

Receptor sequence

>4jlwA (length=395) Species: 557722 (Pseudomonas aeruginosa LESB58)

GNRGVVYLGPGKVEVQNIPYPKMQDPQGRQIDHGVILRVVSTNICGSDQH
MVRGRTTAPEGLVLGHEITGEVVEIGRGVETMKIGDLVSVPFNVACGHCR
TCKEQHTGVCLTVNPARAGGAYGYVDMGGWVGGQAEYVLVPYADFNLLKL
PNREAAMEKIRDLTCLSDILPTGYHGAVTAGVGPGSTVYIAGAGPVGLAA
AASARLLGAAVVIVGDVNPTRLAHAKKQGFEIADLSKDTPLHEQIAALLG
EPEVDCAVDAVGFEARGHGHSGSQQEAPATVLNSLMGITRVAGKIGIPGL
YVTEDPGAVDAAAKHGALSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAI
MWDRIKIADIVGVEVITLDDAPKGYGEFDAGVPKKFVIDPHNLFR

3D structure

• PDB: 4jlw Structure of formaldehyde dehydrogenase from Pseudomonas aeruginosa: the binary complex with the cofactor NAD+.
• Chain: A
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C98 C101 C104 C112	C96 C99 C102 C110
BS02	ZN	A	C47 H68 D170	C45 H66 D168
BS03	NAD	A	C47 G48 S49 H52 D170 T174 G196 P197 V198 D218 R223 V263 R268 H270 V283 P300 L302 Q338 T339	C45 G46 S47 H50 D168 T172 G194 P195 V196 D216 R221 V261 R266 H268 V281 P298 L300 Q336 T337

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 19:42:10 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4jlw', asym_id = 'A', title = 'Structure of formaldehyde dehydrogenase from Pse...inosa: the binary complex with the cofactor NAD+.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4jlw', asym_id='A', title='Structure of formaldehyde dehydrogenase from Pse...inosa: the binary complex with the cofactor NAD+.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0008270,0016491', uniprot = '', pdbid = '4jlw', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008270,0016491', uniprot='', pdbid='4jlw', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>