Structure of PDB 4jlm Chain A

Receptor sequence
>4jlmA (length=233) Species: 9606 (Homo sapiens) [Search protein sequence]
TRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNELTMEQKN
GGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFE
RSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIY
LQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDY
LQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
3D structure
PDB4jlm Structural characterization of new deoxycytidine kinase inhibitors rationalizes the affinity-determining moieties of the molecules.
ChainA
Resolution2.18 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E53 R128
Catalytic site (residue number reindexed from 1) E35 R101
Enzyme Commision number 2.7.1.113: deoxyguanosine kinase.
2.7.1.74: deoxycytidine kinase.
2.7.1.76: deoxyadenosine kinase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 1NN A E53 V55 M85 Y86 P89 Q97 D133 F137 S144 Y204 E35 V37 M58 Y59 P62 Q70 D106 F110 S117 Y177 MOAD: Ki=6.1nM
PDBbind-CN: -logKd/Ki=7.64,IC50=22.7nM
BindingDB: IC50=7.0nM
BS02 1NN A I30 Y86 R194 E196 E197 G199 I200 P201 Y204 I12 Y59 R167 E169 E170 G172 I173 P174 Y177 MOAD: Ki=6.1nM
PDBbind-CN: -logKd/Ki=7.64,IC50=22.7nM
BindingDB: IC50=7.0nM
BS03 UDP A A31 G33 K34 S35 T36 R188 R192 D241 F242 K243 A13 G15 K16 S17 T18 R161 R165 D214 F215 K216
Gene Ontology
Molecular Function
GO:0004136 deoxyadenosine kinase activity
GO:0004137 deoxycytidine kinase activity
GO:0004138 deoxyguanosine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0019136 deoxynucleoside kinase activity
GO:0042803 protein homodimerization activity
GO:0043771 cytidine kinase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006220 pyrimidine nucleotide metabolic process
GO:0009224 CMP biosynthetic process
GO:0016310 phosphorylation
GO:0106383 dAMP salvage
GO:1901135 carbohydrate derivative metabolic process
GO:1901293 nucleoside phosphate biosynthetic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4jlm, PDBe:4jlm, PDBj:4jlm
PDBsum4jlm
PubMed24419380
UniProtP27707|DCK_HUMAN Deoxycytidine kinase (Gene Name=DCK)

[Back to BioLiP]