Structure of PDB 4jl5 Chain A

Receptor sequence
>4jl5A (length=203) Species: 224324 (Aquifex aeolicus VF5) [Search protein sequence]
MILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPLGKKAK
EYMERGELVPDDLIIALIEEVFPKHGNVIFDGFPRTVKQAEALDEMLEKK
GLKVDHVLLFEVPDEVVIERLSGRRINPETGEVYHVKYNPPPPGVKVIQR
EDDKPEVIKKRLEVYREQTAPLIEYYKKKGILRIIDASKPVEEVYRQVLE
VIG
3D structure
PDB4jl5 The energy landscape of adenylate kinase during catalysis.
ChainA
Resolution1.24 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K13 R85 R124 R150 R161
Catalytic site (residue number reindexed from 1) K13 R85 R124 R150 R161
Enzyme Commision number 2.7.4.3: adenylate kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP A G10 G12 K13 G14 T15 R120 R124 V133 Y134 H135 Y138 V191 G10 G12 K13 G14 T15 R120 R124 V133 Y134 H135 Y138 V191
BS02 ADP A T31 G32 L35 R36 M53 E57 V59 I64 R85 Q89 R124 R150 R161 T31 G32 L35 R36 M53 E57 V59 I64 R85 Q89 R124 R150 R161
Gene Ontology
Molecular Function
GO:0004017 adenylate kinase activity
GO:0004550 nucleoside diphosphate kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016776 phosphotransferase activity, phosphate group as acceptor
GO:0019205 nucleobase-containing compound kinase activity
GO:0050145 nucleoside monophosphate kinase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0009123 nucleoside monophosphate metabolic process
GO:0009132 nucleoside diphosphate metabolic process
GO:0009165 nucleotide biosynthetic process
GO:0016310 phosphorylation
GO:0044209 AMP salvage
GO:0046940 nucleoside monophosphate phosphorylation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jl5, PDBe:4jl5, PDBj:4jl5
PDBsum4jl5
PubMed25580578
UniProtO66490|KAD_AQUAE Adenylate kinase (Gene Name=adk)

[Back to BioLiP]