Structure of PDB 4jjn Chain A

Receptor sequence

>4jjnA (length=98) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

PHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS

3D structure

PDB

4jjn Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.

Chain

Resolution

3.09 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	H39 Y41 P43 G44 V46 A47 R49 R63 K64 L65 P66 R69 R83	H2 Y4 P6 G7 V9 A10 R12 R26 K27 L28 P29 R32 R46
BS02	dna	A	Y41 K42 T45 R63 R72 F84 Q85 S86 R116 V117 T118 Q120	Y4 K5 T8 R26 R35 F47 Q48 S49 R79 V80 T81 Q83

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0008823	cupric reductase (NADH) activity
GO:0030527	structural constituent of chromatin
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0006325	chromatin organization
GO:0006355	regulation of DNA-templated transcription
GO:0006878	intracellular copper ion homeostasis
GO:0009060	aerobic respiration
GO:0009303	rRNA transcription
GO:0042790	nucleolar large rRNA transcription by RNA polymerase I
GO:0043935	sexual sporulation resulting in formation of a cellular spore
GO:0045943	positive regulation of transcription by RNA polymerase I
GO:0070911	global genome nucleotide-excision repair

	Cellular Component
GO:0000500	RNA polymerase I upstream activating factor complex
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0031298	replication fork protection complex
GO:0032991	protein-containing complex
GO:0043505	CENP-A containing nucleosome

External links

PDB	RCSB:4jjn, PDBe:4jjn, PDBj:4jjn
PDBsum	4jjn
PubMed	23650358
UniProt	P61830\|H3_YEAST Histone H3 (Gene Name=HHT1)