Structure of PDB 4jh2 Chain A |
>4jh2A (length=138) Species: 222523 (Bacillus cereus ATCC 10987) [Search protein sequence] |
MLNGINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALN EEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRD CESIYFVDPDGHKFEFHSGTLQDRLNYYREDKPHMTFY |
|
PDB | 4jh2 Structural and Chemical Aspects of Resistance to the Antibiotic Fosfomycin Conferred by FosB from Bacillus cereus. |
Chain | A |
Resolution | 1.27 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H66 E115 |
H66 E115 |
|
|
|
|