Structure of PDB 4jcz Chain A

Receptor sequence

>4jczA (length=147) Species: 9606 (Homo sapiens) [Search protein sequence]

HHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERV
YRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYAR
SAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTL

3D structure

PDB

4jcz Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.

Chain

Resolution

2.75 Å

3D
structure

Enzymatic activity

Enzyme Commision number

2.5.1.-
4.4.1.20: leukotriene-C4 synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTX	A	N55 E58 Y59 Y93 R104 L108 L115 W116	N56 E59 Y60 Y94 R105 L109 L116 W117

Gene Ontology

	Molecular Function
GO:0004364	glutathione transferase activity
GO:0004464	leukotriene-C4 synthase activity
GO:0004602	glutathione peroxidase activity
GO:0005515	protein binding
GO:0008047	enzyme activator activity
GO:0008289	lipid binding
GO:0016740	transferase activity
GO:0016829	lyase activity
GO:0042802	identical protein binding

	Biological Process
GO:0006629	lipid metabolic process
GO:0006691	leukotriene metabolic process
GO:0019370	leukotriene biosynthetic process
GO:0042759	long-chain fatty acid biosynthetic process
GO:0098869	cellular oxidant detoxification

	Cellular Component
GO:0005634	nucleus
GO:0005635	nuclear envelope
GO:0005640	nuclear outer membrane
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0016020	membrane
GO:0031965	nuclear membrane
GO:0043231	intracellular membrane-bounded organelle

External links

PDB	RCSB:4jcz, PDBe:4jcz, PDBj:4jcz
PDBsum	4jcz
PubMed	24366866
UniProt	Q16873\|LTC4S_HUMAN Leukotriene C4 synthase (Gene Name=LTC4S)