Structure of PDB 4jb1 Chain A

Receptor sequence

>4jb1A (length=337) Species: 208964 (Pseudomonas aeruginosa PAO1)

LELQEHCSLKPYNTFGIDVRARLLAHARDEADVREALALARERGLPLLVI
GGGSNLLLTRDVEALVLRMASQGRRIVSDAADSVLVEAEAGEAWDPFVQW
SLERGLAGLENLSLIPGTVGAAPMQNIGAYGVELKDVFDSLTALDRQDGT
LREFDRQACRFGYRDSLFKQEPDRWLILRVRLRLTRRERLHLDYGPVRQR
LEEEGIASPTARDVSRVICAIRREKLPDPAVLGNAGSFFKNPLVDATQAE
RLRQAFPDLVGYPQADGRLKLAAGWLIDKGGWKGFRDGPVGVHAQQALVL
VNHGGATGAQVRALAERIQEDVRRRFGVELEPEPNLY

3D structure

• PDB: 4jb1 Substrate Channel Flexibility in Pseudomonas aeruginosa MurB Accommodates Two Distinct Substrates.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R166 S239 E335
• Catalytic site (residue number reindexed from 1): R164 S237 E333
• Enzyme Commision number: 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	V51 G53 G54 G55 S56 N57 L58 I117 P118 G119 T120 A123 M126 Q127 I129 G130 I179 R224 A237 G238 N337 Y339	V49 G51 G52 G53 S54 N55 L56 I115 P116 G117 T118 A121 M124 Q125 I127 G128 I177 R222 A235 G236 N335 Y337
BS02	NAP	A	A131 Y132 Y196 R224 K227 S239 N243 Y264 K272 E335	A129 Y130 Y194 R222 K225 S237 N241 Y262 K270 E333

Gene Ontology

Molecular Function

• GO:0008762 UDP-N-acetylmuramate dehydrogenase activity
• GO:0016491 oxidoreductase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0071949 FAD binding

Biological Process

• GO:0008360 regulation of cell shape
• GO:0009252 peptidoglycan biosynthetic process
• GO:0051301 cell division
• GO:0071555 cell wall organization

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4jb1, PDBe:4jb1, PDBj:4jb1
• PDBsum: 4jb1
• PubMed: 23805286
• UniProt: Q9HZM7|MURB_PSEAE UDP-N-acetylenolpyruvoylglucosamine reductase (Gene Name=murB)