Structure of PDB 4jap Chain A

Receptor sequence

>4japA (length=353) Species: 1773 (Mycobacterium tuberculosis)

MSVIAGVFGALPPHRYSQSEITDSFVEFPGLKEHEEIIRRLHAAAKVNGR
HLVLPLQQYPSLTDFGDANEIFIEKAVDLGVEALLGALDDANLRPSDIDM
IATATVTGVAVPSLDARIAGRLGLRPDVRRMPLFGLGCVAGAAGVARLRD
YLRGAPDDVAVLVSVELCSLTYPAVKPTVSSLVGTALFGDGAAAVVAVGD
RRAEQVRAGGPDILDSRSSLYPDSLHIMGWDVGSHGLRLRLSPDLTNLIE
RYLANDVTTFLDAHRLTKDDIGAWVSHPGGPKVIDAVATSLALPPEALEL
TWRSLGEIGNLSSASILHILRDTIEKRPPSGSAGLMLAMGPGFCTELVLL
RWR

3D structure

• PDB: 4jap Crystal structure of Mycobacterium tuberculosis polyketide synthase 11 (PKS11) reveals intermediates in the synthesis of methyl-branched alkylpyrones.
• Chain: A
• Resolution: 1.833 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C138 F188 H277 N310
• Catalytic site (residue number reindexed from 1): C138 F188 H277 N310
• Enzyme Commision number: 2.3.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	14U	A	F28 G137 C138 S169 T185 F188 M228 W230 P341	F28 G137 C138 S169 T185 F188 M228 W230 P341

Gene Ontology

Molecular Function

• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups

Biological Process

• GO:0006631 fatty acid metabolic process
• GO:0006633 fatty acid biosynthetic process
• GO:0008610 lipid biosynthetic process
• GO:0009058 biosynthetic process
• GO:0009715 chalcone biosynthetic process
• GO:0030639 polyketide biosynthetic process
• GO:0071770 DIM/DIP cell wall layer assembly

Cellular Component

• GO:0034081 polyketide synthase complex

External links

• PDB: RCSB:4jap, PDBe:4jap, PDBj:4jap
• PDBsum: 4jap
• PubMed: 23615910
• UniProt: P9WPF3|PKS11_MYCTU Methyl-branched alkylpyrone synthesis polyketide synthase-like Pks11 (Gene Name=pks11)