Structure of PDB 4j7l Chain A

Receptor sequence

>4j7lA (length=358) Species: 10090 (Mus musculus)

PSLRTQPSLYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPIN
GPGPDFDLRDGYPDRYQPRDEEVQERLDHLLRWVLEHRNQLEGGPGWLAG
ATVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPAARAQRLA
RPPLLRELMYMGYKFEQYMCADKPGGSPDPSGEVNTNVAYCSVLRSRLGN
HPLLFSGEVDCLNPQAPCTQPPSCYVELKTSKEMHSPGQWRSFYRHKLLK
WWAQSFLPGVPHVVAGFRNPEGFVCSLKTFPTMEMFENVRNDREGWNPSV
CMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHRDAPYAFLPS
WYVETMTQ

3D structure

• PDB: 4j7l A mammalian pre-mRNA 5' end capping quality control mechanism and an unexpected link of capping to pre-mRNA processing.
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 3.1.13.-
  3.6.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	E144 R145 Q146 L181 L184 M185 G188 Y189 D236 E253 K255 T256 K258 H272 K273 K276 R294	E118 R119 Q120 L155 L158 M159 G162 Y163 D210 E227 K229 T230 K232 H246 K247 K250 R268
BS02	UBD	A	R30 T31 Q32 G358 G359 P360	R4 T5 Q6 G332 G333 P334
BS03	MG	A	D236 E253 L254	D210 E227 L228
BS04	MG	A	E234 D236	E208 D210

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0004527 exonuclease activity
• GO:0008409 5'-3' exonuclease activity
• GO:0034353 mRNA 5'-diphosphatase activity
• GO:0046872 metal ion binding
• GO:0110152 RNA NAD+-cap (NAD+-forming) hydrolase activity

Biological Process

• GO:0006402 mRNA catabolic process
• GO:0050779 RNA destabilization
• GO:0071028 nuclear mRNA surveillance
• GO:0090304 nucleic acid metabolic process
• GO:0110155 NAD-cap decapping

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:4j7l, PDBe:4j7l, PDBj:4j7l
• PDBsum: 4j7l
• PubMed: 23523372
• UniProt: O70348|DXO_MOUSE Decapping and exoribonuclease protein (Gene Name=Dxo)