Structure of PDB 4j6w Chain A

Receptor sequence
>4j6wA (length=67) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
HSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMV
YKHAISTVVPSRPVRLP
3D structure
PDB4j6w Hfq binds ribonucleotides in three different RNA-binding sites.
ChainA
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CTP A Y25 G29 T61 Y21 G25 T57
BS02 C A H5 Q8 Q41 F42 K56 H1 Q4 Q37 F38 K52
BS03 MG A F39 D40 K56 F35 D36 K52
BS04 CTP A F42 Y55 H57 F38 Y51 H53
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
GO:0009372 quorum sensing
GO:0043487 regulation of RNA stability
GO:0043609 regulation of carbon utilization
GO:0045974 regulation of translation, ncRNA-mediated
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4j6w, PDBe:4j6w, PDBj:4j6w
PDBsum4j6w
PubMed23897473
UniProtQ9HUM0|HFQ_PSEAE RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]