Structure of PDB 4j2x Chain A

Receptor sequence

>4j2xA (length=420) Species: 10090 (Mus musculus)

PPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLM
GSGWKKKKEQMETDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAK
TLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKN
ADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLD
DDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDA
DDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEQNKEMINDGA
SWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQ
NFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPV
TLVRNDGVIYSTSLTFTYTP

3D structure

• PDB: 4j2x Structure and Function of the CSL-KyoT2 Corepressor Complex: A Negative Regulator of Notch Signaling.
• Chain: A
• Resolution: 2.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	N235 F236 E259 E260 F261 T262 V263 D265 M283 A284 P286 R330 I332 Q333	N183 F184 E207 E208 F209 T210 V211 D213 M231 A232 P234 R278 I280 Q281
BS02	peptide	A	L66 R69 Q449 L466	L14 R17 Q397 L414
BS03	dna	A	K84 Y86 S191 K192 R220 Q222	K32 Y34 S139 K140 R168 Q170	PDBbind-CN: Kd=0.011uM
BS04	dna	A	K90 R91 F92 K192 R218 S221 T223 K295 K311	K38 R39 F40 K140 R166 S169 T171 K243 K259	PDBbind-CN: Kd=0.011uM

Gene Ontology

Molecular Function

• GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
• GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006357 regulation of transcription by RNA polymerase II

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:4j2x, PDBe:4j2x, PDBj:4j2x
• PDBsum: 4j2x
• PubMed: 24290140
• UniProt: P31266|SUH_MOUSE Recombining binding protein suppressor of hairless (Gene Name=Rbpj)