Structure of PDB 4irw Chain A

Receptor sequence
>4irwA (length=123) Species: 1895 (Streptomyces avidinii) [Search protein sequence]
GAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRY
DSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLL
TSGTTEANAWKSTLVGHDTFTKV
3D structure
PDB4irw Co-crystallization of streptavidin-biotin complex with a lanthanide-ligand complex gives rise to a novel crystal form
ChainA
Resolution1.396 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PDC A G38 N39 G38 N39
BS02 PDC A N71 N72 Y73 N75 N71 N72 Y73 N75
BS03 PDC A E34 E41 S42 E34 E41 S42
BS04 PDC A E41 S42 Y73 E41 S42 Y73
BS05 PDC A N39 L114 N39 L114
BS06 PDC A D26 R49 D26 R49
BS07 PDC A A28 R49 A28 R49
BS08 BTN A S17 Y33 S35 V37 N39 W69 T80 W98 D118 S17 Y33 S35 V37 N39 W69 T80 W98 D118 BindingDB: Kd=1.000000nM
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4irw, PDBe:4irw, PDBj:4irw
PDBsum4irw
PubMed
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]