Structure of PDB 4iri Chain A

Receptor sequence
>4iriA (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]
GQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKP
NMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPH
3D structure
PDB4iri Structural and dynamic studies of the transcription factor ERG reveal DNA binding is allosterically autoinhibited.
ChainA
Resolution2.77 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y345 R350 R353 Y356 K363 R368 Y369 Y54 R59 R62 Y65 K72 R77 Y78 PDBbind-CN: Kd=37nM
BS02 dna A Q295 W334 K338 M343 K347 R350 Y354 Y355 K358 Q4 W43 K47 M52 K56 R59 Y63 Y64 K67 PDBbind-CN: Kd=37nM
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4iri, PDBe:4iri, PDBj:4iri
PDBsum4iri
PubMed23898196
UniProtP11308|ERG_HUMAN Transcriptional regulator ERG (Gene Name=ERG)

[Back to BioLiP]