Structure of PDB 4ir3 Chain A |
>4ir3A (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] |
SMSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVI KKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGH NMRKYFEKKWTDTFKV |
|
PDB | 4ir3 Discovery and Characterization of GSK2801, a Selective Chemical Probe for the Bromodomains BAZ2A and BAZ2B. |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
1FK |
A |
W1887 P1888 I1950 |
W32 P33 I95 |
|
|
|