Structure of PDB 4ioa Chain A

Receptor sequence

>4ioaA (length=240) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]

LTEALPKTGGRNNRGRITSRFIGGGHKRLYRIIDFKRRDKSGVNAKVAAI
EYDPNRSARIALLHYADGEKRYILAPEGLTVGATVNAGPEAEPKLGNALP
LRFVPVGAVVHALELVPGKGAQLARSAGTSVQVQGKESDYVIVRLPSGEL
RRVHSECYATIGAVGNAEHKNIVLGKAGRSRWLGRKPHQRGSAMNPVDHP
HGGGEGRTGAGRVPVTPWGKPTKGLKTRRKRKTSDRFIVT

3D structure

PDB

4ioa Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	P38 K39 G41 R43 N45 G47 R48 I49 T50 S51 R52 G55 H58 K59 R60 L61 Y62 R63 Y84 P86 R88 H96 D99 G100 K102 P149 K151 Q154 L155 A156 R157 S158 A159 G160 T161 Y172 P178 S179 E181 R183 H186 E188 E200 H201 V205 L206 G207 K208 A209 R211 S212 R213 W214 R217 K218 P219 H220 Q221 R222 G223 S224 A225 M226 N227 P228 V229 D230 H231 H233 G235 G236 E237 G238 R239 T240 G241 A242 G243 R244 P246 V247 P249 W250 K252 P253 T254 K255 G256 L257 K258 R260 R261 K262 R263	P6 K7 G9 R11 N13 G15 R16 I17 T18 S19 R20 G23 H26 K27 R28 L29 Y30 R31 Y52 P54 R56 H64 D67 G68 K70 P117 K119 Q122 L123 A124 R125 S126 A127 G128 T129 Y140 P146 S147 E149 R151 H154 E156 E168 H169 V173 L174 G175 K176 A177 R179 S180 R181 W182 R185 K186 P187 H188 Q189 R190 G191 S192 A193 M194 N195 P196 V197 D198 H199 H201 G203 G204 E205 G206 R207 T208 G209 A210 G211 R212 P214 V215 P217 W218 K220 P221 T222 K223 G224 L225 K226 R228 R229 K230 R231

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4ioa, PDBe:4ioa, PDBj:4ioa
PDBsum	4ioa
PubMed	23414806
UniProt	Q9RXJ9\|RL2_DEIRA Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]