Structure of PDB 4inw Chain A |
>4inwA (length=140) Species: 680683 (Amyelois transitella) [Search protein sequence] |
SPEIMKDLSINFGKALDTCKKELDLPDSINEDFYKFWKEDYEITNRLTGC AIKCLSEKLEMVDADGKLHHGNAREFAMKHGADDAMAKQLVDLIHGCEKS IPPNDDRCMEVLSIAMCFKKEIHNLKWAPNMEVVVGEVLA |
|
PDB | 4inw Crystallographic Observation of pH-Induced Conformational Changes in the Amyelois transitella Pheromone-Binding Protein AtraPBP1. |
Chain | A |
Resolution | 1.14 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
1EY |
A |
M5 L8 F12 R107 |
M5 L8 F12 R107 |
|
|
|
|