Structure of PDB 4imo Chain A

Receptor sequence
>4imoA (length=155) Species: 9606 (Homo sapiens) [Search protein sequence]
VSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAALSMCKSVVAPATDGGL
NLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQ
YALLYSQGSKGPGEDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTI
VFLPQ
3D structure
PDB4imo Structural and dynamic insights into substrate binding and catalysis of human lipocalin prostaglandin D synthase.
ChainA
Resolution1.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 5.3.99.2: prostaglandin-D synthase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PWZ A W54 W112 Y116 P139 F143 W27 W85 Y89 P112 F116
BS02 PWZ A S45 Y107 S109 W112 S18 Y80 S82 W85
Gene Ontology
Molecular Function
GO:0004667 prostaglandin-D synthase activity
GO:0005501 retinoid binding
GO:0005504 fatty acid binding
GO:0005515 protein binding
GO:0016853 isomerase activity
GO:0036094 small molecule binding
Biological Process
GO:0001516 prostaglandin biosynthetic process
GO:0010467 gene expression
GO:0019371 cyclooxygenase pathway
GO:0043303 mast cell degranulation
GO:0045187 regulation of circadian sleep/wake cycle, sleep
GO:0051384 response to glucocorticoid
GO:2000255 negative regulation of male germ cell proliferation
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005791 rough endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0016020 membrane
GO:0031965 nuclear membrane
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4imo, PDBe:4imo, PDBj:4imo
PDBsum4imo
PubMed23526831
UniProtP41222|PTGDS_HUMAN Prostaglandin-H2 D-isomerase (Gene Name=PTGDS)

[Back to BioLiP]