Structure of PDB 4ilz Chain A

Receptor sequence
>4ilzA (length=137) Species: 129555 (Amphitrite ornata) [Search protein sequence]
GFKQDIATIRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKSDQELKSMA
KFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKL
FVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK
3D structure
PDB4ilz Structural and Kinetic Study of an Internal Substrate Binding Site in Dehaloperoxidase-Hemoglobin A from Amphitrite ornata.
ChainA
Resolution1.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A F24 F35 H55 V59 L62 L83 Q88 H89 L92 N96 F97 F24 F35 H55 V59 L62 L83 Q88 H89 L92 N96 F97
BS02 IPA A P29 R32 P29 R32
BS03 IPA A M108 R109 S111 Q113 M108 R109 S111 Q113
BS04 IPA A R32 K41 S42 D43 L46 R32 K41 S42 D43 L46
BS05 TBP A I20 F21 F24 V59 F60 M63 L100 I20 F21 F24 V59 F60 M63 L100
BS06 OXY A H55 V59 H55 V59
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0098869 cellular oxidant detoxification

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ilz, PDBe:4ilz, PDBj:4ilz
PDBsum4ilz
PubMed23480178
UniProtQ9NAV8

[Back to BioLiP]