Structure of PDB 4ilm Chain A

Receptor sequence

>4ilmA (length=279) Species: 273057 (Saccharolobus solfataricus P2)

MPLIFKIGYNVIPLQDVILPTPSSKVLKYLIQSGKLIPSLKDLITSRDKY
KPIFISHLGFNQRRIFQTNKTITKGSRLSSIIAFSTQANVLSEVADEGIF
ETVYGKFHIMIESIEIVEVEKLKEEVEKHMNDNIRVRFVSPTLLSSKVLL
PPSLSERYKKIHAGYSTLPSVGLIVAYAYNVYCNLIGKKEVEVRAFKFGI
LSNALSRIIGYDLHPVTVAIGEDSNLRKARGVMGWIEFDIPDERLKRRAL
NYLLTSSYLGIGRSRGIGFGEIRLEFRKI

3D structure

• PDB: 4ilm Recognition and cleavage of a nonstructured CRISPR RNA by its processing endoribonuclease Cas6.
• Chain: A
• Resolution: 3.068 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	R47 D48 K49 Y50 K51 S148 K150 V151 L153 S158 H165 G167 Y168 Y180 E195 H217 T220 D226 R232 K233 A234 R235 R268 S269 R270 I272	R47 D48 K49 Y50 K51 S145 K147 V148 L150 S155 H162 G164 Y165 Y177 E192 H214 T217 D223 R227 K228 A229 R230 R263 S264 R265 I267
BS02	rna	A	N136 R210 I211 I212 G213 Y214	N133 R207 I208 I209 G210 Y211

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004519 endonuclease activity
• GO:0016788 hydrolase activity, acting on ester bonds

Biological Process

• GO:0051607 defense response to virus

External links

• PDB: RCSB:4ilm, PDBe:4ilm, PDBj:4ilm
• PDBsum: 4ilm
• PubMed: 23454186
• UniProt: Q97WV8|CAS6B_SACS2 CRISPR-associated endoribonuclease Cas6 2 (Gene Name=cas6b)