Structure of PDB 4ill Chain A

Receptor sequence

>4illA (length=278) Species: 273057 (Saccharolobus solfataricus P2)

MPLIFKIGYNVIPLQDVILPTPSSKVLKYLIQSGKLIPSLKDLITSRDKY
KPIFISHLGFNQRRIFQKTITKGSRLSSIIAFSTQANVLSEVADEGIFET
VYGKFHIMIESIEIVEVEKLKEEVEKHMNDNIRVRFVSPTLLSSKVLLPP
SLSERYKKIHAGYSTLPSVGLIVAYAYNVYCNLIGKKEVEVRAFKFGILS
NALSRIIGYDLHPVTVAIGESKGNLRKARGVMGWIEFDIPDERLKRRALN
YLLTSSYLGIGRSRGIGFGEIRLEFRKI

3D structure

• PDB: 4ill Recognition and cleavage of a nonstructured CRISPR RNA by its processing endoribonuclease Cas6.
• Chain: A
• Resolution: 2.484 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	K25 K28 Y29 Q32 S33 K41 T45 R47 D48 K49 Y50 K51 S148 K150 V151 K162 G167 Y168 Y180 N230 R232 K233 R235 R268 S269 R270 G271 I272	K25 K28 Y29 Q32 S33 K41 T45 R47 D48 K49 Y50 K51 S143 K145 V146 K157 G162 Y163 Y175 N224 R226 K227 R229 R262 S263 R264 G265 I266
BS02	rna	A	N136 R210 I212 G213 Y214 D244 R282	N131 R205 I207 G208 Y209 D238 R276

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004519 endonuclease activity
• GO:0016788 hydrolase activity, acting on ester bonds

Biological Process

• GO:0051607 defense response to virus

External links

• PDB: RCSB:4ill, PDBe:4ill, PDBj:4ill
• PDBsum: 4ill
• PubMed: 23454186
• UniProt: Q97WV8|CAS6B_SACS2 CRISPR-associated endoribonuclease Cas6 2 (Gene Name=cas6b)