Structure of PDB 4iga Chain A

Receptor sequence
>4igaA (length=116) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence]
KRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVT
MDITMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFI
VKPFQPSRVVEALNKV
3D structure
PDB4iga The crystal structure of an activated Thermotoga maritima CheY with N-terminal region of FliM.
ChainA
Resolution1.73 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A G85 Q86 Q87 I94 F101 V103 R110 G83 Q84 Q85 I92 F99 V101 R108
BS02 MG A D10 D54 T56 D8 D52 T54
BS03 BEF A D54 I55 T56 S82 A83 K104 D52 I53 T54 S80 A81 K102
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006935 chemotaxis
GO:0097588 archaeal or bacterial-type flagellum-dependent cell motility
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4iga, PDBe:4iga, PDBj:4iga
PDBsum4iga
PubMed23237794
UniProtQ56312|CHEY_THEMA Chemotaxis protein CheY (Gene Name=cheY)

[Back to BioLiP]