Structure of PDB 4if7 Chain A

Receptor sequence

>4if7A (length=282) Species: 1773 (Mycobacterium tuberculosis)

RTALSPGVLSPTRPVPNWIARPEYVGKPAAQEGSEPWVQTPEVIEKMRVA
GRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFPKS
CCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGDVA
DEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRDFT
GHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGALDYEIWDD
GWTVVTKDRKWTAQFEHTLLVTDTGVEILTCL

3D structure

• PDB: 4if7 Selective targeting of the conserved active site cysteine of Mycobacterium tuberculosis methionine aminopeptidase with electrophilic reagents
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H114 D131 D142 G204 H205 G208 H212 L215 E238 N242 E269
• Catalytic site (residue number reindexed from 1): H111 D128 D139 G201 H202 G205 H209 L212 E235 N239 E266
• Enzyme Commision number: 3.4.11.18: methionyl aminopeptidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CO	A	D142 H205 T236 E238 E269	D139 H202 T233 E235 E266
BS02	CO	A	D131 D142 E269	D128 D139 E266
BS03	HCM	A	Y97 F100 H114 D131 D142 F211 H212 E238 E269	Y94 F97 H111 D128 D139 F208 H209 E235 E266

Gene Ontology

Molecular Function

• GO:0004177 aminopeptidase activity
• GO:0004239 initiator methionyl aminopeptidase activity
• GO:0005506 iron ion binding
• GO:0008235 metalloexopeptidase activity
• GO:0046872 metal ion binding
• GO:0046914 transition metal ion binding
• GO:0050897 cobalt ion binding
• GO:0070006 metalloaminopeptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0016485 protein processing

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4if7, PDBe:4if7, PDBj:4if7
• PDBsum: 4if7
• PubMed: 24841365
• UniProt: P9WK19|MAP12_MYCTU Methionine aminopeptidase 2 (Gene Name=map)