Structure of PDB 4i9r Chain A

Receptor sequence
>4i9rA (length=137) Species: 9606 (Homo sapiens) [Search protein sequence]
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIWVAAASKPAVEIKQEGDTF
YIKVSTTVWTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLL
KGEGPKTSWTKELTNDGELILTMTADDVVCTLVFVRE
3D structure
PDB4i9r Rational Design of a Colorimetric pH Sensor from a Soluble Retinoic Acid Chaperone.
ChainA
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 RET A F15 P39 V54 W109 K111 L121 M123 F15 P39 V54 W109 K111 L121 M123 PDBbind-CN: -logKd/Ki=6.95,Kd=112nM
Gene Ontology
Molecular Function
GO:0001972 retinoic acid binding
GO:0005501 retinoid binding
GO:0005504 fatty acid binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0016918 retinal binding
GO:0019841 retinol binding
GO:0030332 cyclin binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0007165 signal transduction
GO:0008544 epidermis development
GO:0015908 fatty acid transport
GO:0035115 embryonic forelimb morphogenesis
GO:0042573 retinoic acid metabolic process
GO:0048672 positive regulation of collateral sprouting
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4i9r, PDBe:4i9r, PDBj:4i9r
PDBsum4i9r
PubMed24059243
UniProtP29373|RABP2_HUMAN Cellular retinoic acid-binding protein 2 (Gene Name=CRABP2)

[Back to BioLiP]