Structure of PDB 4i8t Chain A |
>4i8tA (length=75) Species: 211595 (Enterobacter sp. RFL1396) [Search protein sequence] |
SFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKS LELIMKGLEVSDVVFFEMLIKEILK |
|
PDB | 4i8t Structural analysis of DNA-protein complexes regulating the restriction-modification system Esp1396I. |
Chain | A |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
A |
R17 T23 Q24 R43 |
R15 T21 Q22 R41 |
|
|
|
|