Structure of PDB 4i85 Chain A |
>4i85A (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] |
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA LLSPYSYSTTAVVTNP |
|
PDB | 4i85 Structural evidence for native state stabilization of a conformationally labile amyloidogenic transthyretin variant by fibrillogenesis inhibitors. |
Chain | A |
Resolution | 1.67 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
H50 |
A |
K15 L17 S117 T118 |
K6 L8 S108 T109 |
|
|
|
|