Structure of PDB 4i49 Chain A

Receptor sequence

>4i49A (length=424) Species: 528360 (Neisseria gonorrhoeae SK-93-1035)

DSFVAHFREAAPYIRQMRGTTLVAGIDGRLLEGGTLNKLAADIGLLSQLG
IRLVLIHGAYHFLDRLAAAQGRTPHYCRGLRVTDETSLGQAQQFAGTVRS
RFEAALCGSSVPLVSGNFLTARPIGVIDGTDMEYAGVIRKTDTAALRFQL
DAGNIVWMPPLGHSYGGKTFNLDMVQAAASVAVSLQAEKLVYLTLSDGIS
RPDGTLAETLSAQEAQSLAEHAASETRRLISSAVAALEGGVHRVQILNGA
ADGSLLQELFTRNGIGTSIAKEAFVSIRQAHSGDIPHIAALIRPLEEQGI
LLHRSREYLENHISEFSILEHDGNLYGCAALKTFAEADCGEIACLAVSPQ
AQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWFAERGFQTASEDEL
PETRRKDYRSNGRNSHILVRRLHR

3D structure

• PDB: 4i49 Structure of the complex of Neisseria gonorrhoeae N-acetyl-l-glutamate synthase with a bound bisubstrate analog.
• Chain: A
• Resolution: 2.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	1C4	A	I312 L313 L314 R316 A355 C356 L357 A358 V359 Q364 D365 G367 G369 E370 L391 S392 T395 W398 F399 R425 S427	I300 L301 L302 R304 A343 C344 L345 A346 V347 Q352 D353 G355 G357 E358 L379 S380 T383 W386 F387 R413 S415

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 21:19:21 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4i49', asym_id = 'A', title = 'Structure of the complex of Neisseria gonorrhoea...utamate synthase with a bound bisubstrate analog.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4i49', asym_id='A', title='Structure of the complex of Neisseria gonorrhoea...utamate synthase with a bound bisubstrate analog.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004042,0005737,0006526,0016747', uniprot = '', pdbid = '4i49', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004042,0005737,0006526,0016747', uniprot='', pdbid='4i49', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>