Structure of PDB 4i1h Chain A

Receptor sequence

>4i1hA (length=306) Species: 9606 (Homo sapiens)

SIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPN
RMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCIT
CTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCV
AGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAG
LLPEPDQRKVTCEGCGFAFCRECKEAYHEGECSVDERAAEQARWEAASKE
TIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMG
DHWFDV

3D structure

• PDB: 4i1h Structure and function of Parkin E3 ubiquitin ligase reveals aspects of RING and HECT ligases.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 2.3.2.31: RBR-type E3 ubiquitin transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C150 C154 C212 H215	C10 C14 C72 H75
BS02	ZN	A	C166 C169 C196 C201	C26 C29 C56 C61
BS03	ZN	A	C238 C241 C260 C263	C98 C101 C120 C123
BS04	ZN	A	C253 H257 C289 C293	C113 H117 C149 C153
BS05	ZN	A	C332 C337 C352 C360	C192 C197 C212 C215
BS06	ZN	A	C365 C368 H373 C377	C220 C223 H228 C232
BS07	ZN	A	C418 C421 C436 C441	C259 C262 C277 C282
BS08	ZN	A	C446 C449 C457 H461	C287 C290 C298 H302

Gene Ontology

Molecular Function

• GO:0004842 ubiquitin-protein transferase activity
• GO:0008270 zinc ion binding

Biological Process

• GO:0016567 protein ubiquitination

Cellular Component

• GO:0005739 mitochondrion
• GO:0005829 cytosol

External links

• PDB: RCSB:4i1h, PDBe:4i1h, PDBj:4i1h
• PDBsum: 4i1h
• PubMed: 23770887
• UniProt: O60260|PRKN_HUMAN E3 ubiquitin-protein ligase parkin (Gene Name=PRKN)