Structure of PDB 4i0b Chain A

Receptor sequence
>4i0bA (length=199) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGK
EMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQ
VNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAM
TLPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
3D structure
PDB4i0b Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
ChainA
Resolution1.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CMP A V50 I71 G72 E73 L74 R83 S84 A85 V87 R124 T128 V42 I63 G64 E65 L66 R75 S76 A77 V79 R116 T120
BS02 CMP A K58 E59 Q171 G174 Q175 G178 C179 S180 R181 K50 E51 Q163 G166 Q167 G170 C171 S172 R173
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003680 minor groove of adenine-thymine-rich DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0008301 DNA binding, bending
GO:0030552 cAMP binding
GO:0042802 identical protein binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045013 carbon catabolite repression of transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4i0b, PDBe:4i0b, PDBj:4i0b
PDBsum4i0b
PubMed24058293
UniProtP0ACJ8|CRP_ECOLI DNA-binding transcriptional dual regulator CRP (Gene Name=crp)

[Back to BioLiP]